Introduction to the SAMSON platform
Here’s the outline of what we’ll be doing today. The documentation links below are provided in case you would like to learn more about a specific topic, but everything will be explained during the lecture.
Part I – Introduction to modeling
Getting around, importing, selecting and inspecting
- Overview of the interface
- Interactive tutorials
- SAMSON AI
- Loading molecules
- Moving around
- Selecting
- Inspecting
Visualizing and animating
Gaming Tournament! Find Lennard-Jones clusters!
Sign into your account, visit the Lennard-Jones model extension, click Add, then do the same for the Cluster Game extension. Then, restart your SAMSON. The two extensions will be automatically installed.
Building molecules, patterns, and more
Part II – GenAI and advanced modeling
Tutorial: Docking ligands into proteins
Try to complete the Docking Tutorial until the part “Visualizing results” (included).
Predicting biomolecular structures and sharing jobs
We will use Boltz-2, an open source equivalent of AlphaFold 3, to predict structures of protein-ligand complexes and binding affinities.
1. Single protein
Add one protein chain (A):
QLEDSEVEAVAKGLEEMYANGVTEDNFKNYVKNNFAQQEISSVEEELNVNISDSCVANKIKDEFFAMISISAIVKAAQKKAWKELAVTVLRFAKANGLKTNAIIVAGQLALWAVQCG
2. Protein and ligands
Add two protein chains (A, B):
MVTPEGNVSLVDESLLVGVTDEDRAVRSAHQFYERLIGLWAPAVMEAAHELGVFAALAEAPADSGELARRLDCDARAMRVLLDALYAYDVIDRIHDTNGFRYLLSAEARECLLPGTLFSLVGKFMHDINVAWPAWRNLAEVVRHGARDTSGAESPNGIAQEDYESLVGGINFWAPPIVTTLSRKLRASGRSGDATASVLDVGCGTGLYSQLLLREFPRWTATGLDVERIATLANAQALRLGVEERFATRAGDFWRGGWGTGYDLVLFANIFHLQTPASAVRLMRHAAACLAPDGLVAVVDQIVDADREPKTPQDRFALLFAASMTNTGGGDAYTFQEYEEWFTAAGLQRIETLDTPMHRILLARRATEPSAVPEGQASENLYFQ
Add two ligands from their CCD code (C, D): SAH
Add two ligands from their SMILES code (E, F): N[C@@H](Cc1ccc(O)cc1)C(=O)O
3. Predicting binding affinities
Add one protein sequence (A): MVTPEGNVSLVDESLLVGVTDEDRAVRSAHQFYERLIGLWAPAVMEAAHELGVFAALAEAPADSGELARRLDCDARAMRVLLDALYAYDVIDRIHDTNGFRYLLSAEARECLLPGTLFSLVGKFMHDINVAWPAWRNLAEVVRHGARDTSGAESPNGIAQEDYESLVGGINFWAPPIVTTLSRKLRASGRSGDATASVLDVGCGTGLYSQLLLREFPRWTATGLDVERIATLANAQALRLGVEERFATRAGDFWRGGWGTGYDLVLFANIFHLQTPASAVRLMRHAAACLAPDGLVAVVDQIVDADREPKTPQDRFALLFAASMTNTGGGDAYTFQEYEEWFTAAGLQRIETLDTPMHRILLARRATEPSAVPEGQASENLYFQ
Add one ligand from its SMILES code (B): N[C@@H](Cc1ccc(O)cc1)C(=O)O
Request affinity calculations for B.
Tutorial: Molecular dynamics simulations
Try to complete the GROMACS Wizard Tutorial until the part “Step 3: NVT equilibration” (included).
Creating and sharing apps
Download the Embedded App Demo document into SAMSON.
